PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf15496g02014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 539aa    MW: 59700.9 Da    PI: 7.5724
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf15496g02014.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA49.94.3e-16741135
                      GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                              C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  Niben101Scf15496g02014.1  7 CYHCGVTSTPLWRNGPPEKPVLCNACGSRWRTKGT 41
                              ****************88888***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004017.5E-11155IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.23E-11445No hitNo description
CDDcd002021.57E-16654No hitNo description
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.0E-12741IPR013088Zinc finger, NHR/GATA-type
PfamPF003207.0E-14741IPR000679Zinc finger, GATA-type
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PfamPF139191.1E-8285372IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MGKEGPCYHC GVTSTPLWRN GPPEKPVLCN ACGSRWRTKG TLANYTPLHA RAEPDDLEDY  60
RVSRVRHMSL KNKEPKLLKR KQNHDNTEVR TPPDYNQGFL KGLDEDTSNR SSSGSAISNT  120
ESCAQFGSTE ASDLTGHAQS NIWDTTVPSR KRTCISRPKQ SSVEKLTKDL YTILHEQQSS  180
CFSGSSEEDL LFASDKPMVS VEIGHGSVLI RHPNSIGRDE ESEVSSLSVD NKRHYVNEAY  240
SRFSTPPVNI NKGVYSPNLG SERIKKPTSQ GVEQDKIKRD EDQLEKLQTL GKHNSPLCHI  300
DLKDVLNYEE LVRHFSSDEQ KQLLKYLAPV DSFAPPDSLK SMFESSHFEE NLSSFQKLLA  360
EGVFDNSLGV KVEDLRILKR LILCYLTKSK WVEKYNLLME TKCKSSTNGS EVAGGPNAIG  420
TGHSVNVKRP LEGHHAKYAG AKKVMKSPNG VVMKSSYEQK ELIGNDSSCF SPKSLFALPC  480
NSSPMLDSLH FANGSSDQEL LLDVPSNSSF PQAELLVPTS SFAAQASTSS SSVYPHVRP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016494465.10.0PREDICTED: GATA transcription factor 26-like
SwissprotQ8W4H11e-150GAT26_ARATH; GATA transcription factor 26
TrEMBLK4C6S40.0K4C6S4_SOLLC; Uncharacterized protein
STRINGSolyc06g060940.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20892462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.31e-152GATA transcription factor 26